Lineage for d1h8ac2 (1h8a C:144-191)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 95027Family a.4.1.3: Myb [46739] (4 proteins)
  6. 95057Protein v-Myb [68960] (1 species)
  7. 95058Species Avian myeloblastosis virus [TaxId:11866] [68961] (1 PDB entry)
  8. 95060Domain d1h8ac2: 1h8a C:144-191 [65732]
    Other proteins in same PDB: d1h8aa_, d1h8ab_

Details for d1h8ac2

PDB Entry: 1h8a (more details), 2.23 Å

PDB Description: crystal structure of ternary protein-dna complex3

SCOP Domain Sequences for d1h8ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ac2 a.4.1.3 (C:144-191) v-Myb {Avian myeloblastosis virus}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnavknhwnstmrr

SCOP Domain Coordinates for d1h8ac2:

Click to download the PDB-style file with coordinates for d1h8ac2.
(The format of our PDB-style files is described here.)

Timeline for d1h8ac2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8ac1