Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
Protein v-Myb [68960] (1 species) |
Species Avian myeloblastosis virus [TaxId:11866] [68961] (1 PDB entry) |
Domain d1h8ac1: 1h8a C:87-143 [65731] Other proteins in same PDB: d1h8aa_, d1h8ab_ repeats 2 & 3 protein/DNA complex |
PDB Entry: 1h8a (more details), 2.23 Å
SCOPe Domain Sequences for d1h8ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ac1 a.4.1.3 (C:87-143) v-Myb {Avian myeloblastosis virus [TaxId: 11866]} npelnkgpwtkeedqrviehvqkygpkrwsdiakhlkgrigkqcrerwhnhlnpevk
Timeline for d1h8ac1: