SCOPe 2.07: Domain d1h8ac1: 1h8a C:87-143

Lineage for d1h8ac1 (1h8a C:87-143)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein v-Myb [68960] (1 species)

7. Species Avian myeloblastosis virus [TaxId:11866] [68961] (1 PDB entry)

8. Domain d1h8ac1: 1h8a C:87-143 [65731]
   Other proteins in same PDB: d1h8aa_, d1h8ab_
   repeats 2 & 3
   protein/DNA complex

Details for d1h8ac1

PDB Entry: 1h8a, 2.23 Å

PDB Description: crystal structure of ternary protein-dna complex3

PDB Compounds: (C:) myb transforming protein

SCOPe Domain Sequences for d1h8ac1:

Sequence; same for both SEQRES and ATOM records:

>d1h8ac1 a.4.1.3 (C:87-143) v-Myb {Avian myeloblastosis virus [TaxId: 11866]}
npelnkgpwtkeedqrviehvqkygpkrwsdiakhlkgrigkqcrerwhnhlnpevk

Timeline for d1h8ac1:

• d1h8ac1 first appeared in SCOP 1.59
  
• d1h8ac1 appears in SCOPe 2.06
  
• d1h8ac1 appears in the current release, SCOPe 2.08