Lineage for d1h8ac1 (1h8a C:87-143)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438260Family a.4.1.3: Myb/SANT domain [46739] (6 proteins)
  6. 438299Protein v-Myb [68960] (1 species)
  7. 438300Species Avian myeloblastosis virus [TaxId:11866] [68961] (1 PDB entry)
  8. 438301Domain d1h8ac1: 1h8a C:87-143 [65731]
    Other proteins in same PDB: d1h8aa_, d1h8ab_

Details for d1h8ac1

PDB Entry: 1h8a (more details), 2.23 Å

PDB Description: crystal structure of ternary protein-dna complex3

SCOP Domain Sequences for d1h8ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ac1 a.4.1.3 (C:87-143) v-Myb {Avian myeloblastosis virus}
npelnkgpwtkeedqrviehvqkygpkrwsdiakhlkgrigkqcrerwhnhlnpevk

SCOP Domain Coordinates for d1h8ac1:

Click to download the PDB-style file with coordinates for d1h8ac1.
(The format of our PDB-style files is described here.)

Timeline for d1h8ac1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h8ac2