Lineage for d1h8ab_ (1h8a B:)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752378Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 752379Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 752408Protein C/ebp beta [57985] (2 species)
  7. 752409Species Human (Homo sapiens) [TaxId:9606] [64590] (8 PDB entries)
  8. 752417Domain d1h8ab_: 1h8a B: [65730]
    Other proteins in same PDB: d1h8ac1, d1h8ac2

Details for d1h8ab_

PDB Entry: 1h8a (more details), 2.23 Å

PDB Description: crystal structure of ternary protein-dna complex3
PDB Compounds: (B:) caat/enhancer binding protein beta

SCOP Domain Sequences for d1h8ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ab_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkql

SCOP Domain Coordinates for d1h8ab_:

Click to download the PDB-style file with coordinates for d1h8ab_.
(The format of our PDB-style files is described here.)

Timeline for d1h8ab_: