![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.3: Leucine zipper domain [57959] (2 families) ![]() |
![]() | Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
![]() | Protein C/ebp beta [57985] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries) |
![]() | Domain d1h8ab_: 1h8a B: [65730] Other proteins in same PDB: d1h8ac1, d1h8ac2 protein/DNA complex |
PDB Entry: 1h8a (more details), 2.23 Å
SCOPe Domain Sequences for d1h8ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8ab_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]} dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl rnlfkql
Timeline for d1h8ab_: