Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) |
Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
Protein C/ebp beta [57985] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries) |
Domain d1h89b_: 1h89 B: [65725] Other proteins in same PDB: d1h89c1, d1h89c2, d1h89c3 protein/DNA complex; complexed with k |
PDB Entry: 1h89 (more details), 2.45 Å
SCOPe Domain Sequences for d1h89b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h89b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]} eykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnlfk qlpe
Timeline for d1h89b_:
View in 3D Domains from other chains: (mouse over for more information) d1h89a_, d1h89c1, d1h89c2, d1h89c3 |