Lineage for d1h88b_ (1h88 B:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145366Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)
  4. 145470Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 145471Family h.1.3.1: Leucine zipper domain [57960] (13 proteins)
  6. 145491Protein C/ebp beta [57985] (2 species)
  7. 145492Species Human (Homo sapiens) [TaxId:9606] [64590] (5 PDB entries)
  8. 145496Domain d1h88b_: 1h88 B: [65720]
    Other proteins in same PDB: d1h88c1, d1h88c2, d1h88c3

Details for d1h88b_

PDB Entry: 1h88 (more details), 2.8 Å

PDB Description: crystal structure of ternary protein-dna complex1

SCOP Domain Sequences for d1h88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h88b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens)}
tvdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrels
tlrnlfkqlpe

SCOP Domain Coordinates for d1h88b_:

Click to download the PDB-style file with coordinates for d1h88b_.
(The format of our PDB-style files is described here.)

Timeline for d1h88b_: