| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (2 families) ![]() |
| Family h.1.3.1: Leucine zipper domain [57960] (17 proteins) |
| Protein C/ebp beta [57985] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries) |
| Domain d1h88b_: 1h88 B: [65720] Other proteins in same PDB: d1h88c1, d1h88c2, d1h88c3 protein/DNA complex; complexed with nh4 |
PDB Entry: 1h88 (more details), 2.8 Å
SCOPe Domain Sequences for d1h88b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h88b_ h.1.3.1 (B:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
tvdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrels
tlrnlfkqlpe
Timeline for d1h88b_:
View in 3DDomains from other chains: (mouse over for more information) d1h88a_, d1h88c1, d1h88c2, d1h88c3 |