Lineage for d1h88a_ (1h88 A:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1466121Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1466343Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1466344Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1466375Protein C/ebp beta [57985] (2 species)
  7. 1466376Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)
  8. 1466387Domain d1h88a_: 1h88 A: [65719]
    Other proteins in same PDB: d1h88c1, d1h88c2, d1h88c3
    protein/DNA complex; complexed with nh4

Details for d1h88a_

PDB Entry: 1h88 (more details), 2.8 Å

PDB Description: crystal structure of ternary protein-dna complex1
PDB Compounds: (A:) ccaat/enhancer binding protein beta

SCOPe Domain Sequences for d1h88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h88a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
vdkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelst
lrnlfkqlpe

SCOPe Domain Coordinates for d1h88a_:

Click to download the PDB-style file with coordinates for d1h88a_.
(The format of our PDB-style files is described here.)

Timeline for d1h88a_: