Lineage for d1h80b_ (1h80 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069178Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069179Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2069331Family b.80.1.8: iota-carrageenase [69333] (1 protein)
  6. 2069332Protein iota-carrageenase [69334] (1 species)
  7. 2069333Species Alteromonas sp., atcc 43554 [TaxId:232] [69335] (2 PDB entries)
  8. 2069335Domain d1h80b_: 1h80 B: [65715]
    complexed with ca, cl, gol, na

Details for d1h80b_

PDB Entry: 1h80 (more details), 1.6 Å

PDB Description: 1,3-alpha-1,4-beta-d-galactose-4-sulfate-3,6-anhydro-d-galactose-2-sulfate 4 galactohydrolase
PDB Compounds: (B:) iota-carrageenase

SCOPe Domain Sequences for d1h80b_:

Sequence, based on SEQRES records: (download)

>d1h80b_ b.80.1.8 (B:) iota-carrageenase {Alteromonas sp., atcc 43554 [TaxId: 232]}
vspktykdadfyvaptqqdvnydlvddfgangndtsddsnalqrainaisrkpnggtlli
pngtyhflgiqmksnvhirvesdviikptwngdgknhrlfevgvnnivrnfsfqglgngf
lvdfkdsrdknlavfklgdvrnykisnftiddnktifasilvdvterngrlhwsrngiie
rikqnnalfgygliqtygadnilfrnlhseggialrmetdnllmknykqggirnifadni
rcskglaavmfgphfmkngdvqvtnvssvscgsavrsdsgfvelfsptdevhtrqswkqa
vesklgrgcaqtpyargnggtrwaarvtqkdacldkakleygiepgsfgtvkvfdvtarf
gynadlkqdqldyfstsnpmckrvclptkeqwskqgqiyigpslaavidttpetskydyd
vktfnvkrinfpvnshktidtntessrvcnyygmsecsssrwer

Sequence, based on observed residues (ATOM records): (download)

>d1h80b_ b.80.1.8 (B:) iota-carrageenase {Alteromonas sp., atcc 43554 [TaxId: 232]}
vspktykdadfyvaptqqdvnydlvddfgangndtsddsnalqrainaisrkpnggtlli
pngtyhflgiqmksnvhirvesdviikptwngdgknhrlfevgvnnivrnfsfqglgngf
lvdfkdsrdknlavfklgdvrnykisnftiddnktifasilvdvterngrlhwsrngiie
rikqnnalfgygliqtygadnilfrnlhseggialrmetdnllmknykqggirnifadni
rcskglaavmfgphfmkngdvqvtnvssvscgsavrsdsgfvelfgcaqtarvtqkdacl
dkakleygiepgsfgtvkvfdvtarfgynadlkqdqldyfstsnpmckrvclptkeqwsk
qgqiyigpslaavidttpetskydydvktfnvkrinfpvnshktidtntessrvcnyygm
secsssrwer

SCOPe Domain Coordinates for d1h80b_:

Click to download the PDB-style file with coordinates for d1h80b_.
(The format of our PDB-style files is described here.)

Timeline for d1h80b_: