Lineage for d1h7sb2 (1h7s B:33-231)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196211Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
  4. 196212Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 196228Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (3 proteins)
  6. 196244Protein DNA mismatch repair protein PMS2 [69800] (1 species)
  7. 196245Species Human (Homo sapiens) [TaxId:9606] [69801] (3 PDB entries)
  8. 196247Domain d1h7sb2: 1h7s B:33-231 [65708]
    Other proteins in same PDB: d1h7sa1, d1h7sb1

Details for d1h7sb2

PDB Entry: 1h7s (more details), 1.95 Å

PDB Description: n-terminal 40kda fragment of human pms2

SCOP Domain Sequences for d1h7sb2:

Sequence, based on SEQRES records: (download)

>d1h7sb2 d.122.1.2 (B:33-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
lslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlkhhtski
qefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprp
rgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrq
pvvctggspsikenigsvf

Sequence, based on observed residues (ATOM records): (download)

>d1h7sb2 d.122.1.2 (B:33-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
lslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlgealssl
calsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefq
rnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvf

SCOP Domain Coordinates for d1h7sb2:

Click to download the PDB-style file with coordinates for d1h7sb2.
(The format of our PDB-style files is described here.)

Timeline for d1h7sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h7sb1