SCOPe 2.05: Domain d1h7sb1: 1h7s B:232-365

Lineage for d1h7sb1 (1h7s B:232-365)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)

6. Protein DNA mismatch repair protein PMS2 [69656] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69657] (3 PDB entries)

8. Domain d1h7sb1: 1h7s B:232-365 [65707]
   Other proteins in same PDB: d1h7sa2, d1h7sb2

Details for d1h7sb1

PDB Entry: 1h7s, 1.95 Å

PDB Description: n-terminal 40kda fragment of human pms2

PDB Compounds: (B:) pms1 protein homolog 2

SCOPe Domain Sequences for d1h7sb1:

Sequence, based on SEQRES records:

>d1h7sb1 d.14.1.3 (B:232-365) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll
lavlktsligmfds

Sequence, based on observed residues (ATOM records):

>d1h7sb1 d.14.1.3 (B:232-365) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdillqeeklllavlktsli
gmfds

Timeline for d1h7sb1:

• d1h7sb1 first appeared in SCOP 1.59
  
• d1h7sb1 appears in SCOPe 2.04
  
• d1h7sb1 appears in SCOPe 2.06
  
• d1h7sb1 appears in the current release, SCOPe 2.08