Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.1: Spore coat polysaccharide biosynthesis protein SpsA [53449] (1 protein) |
Protein Spore coat polysaccharide biosynthesis protein SpsA [53450] (1 species) |
Species Bacillus subtilis [TaxId:1423] [53451] (5 PDB entries) |
Domain d1h7qa_: 1h7q A: [65704] complexed with mg, mn, tyd |
PDB Entry: 1h7q (more details), 2 Å
SCOPe Domain Sequences for d1h7qa_:
Sequence, based on SEQRES records: (download)
>d1h7qa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka viysasktyhlnenrdivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywd espafyrigdarffwrvnhfypfypldeeldlnyitdqsihfqlfeleknefvrnlppqr ncrelreslkklgmg
>d1h7qa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka viysasktyhlndivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywdesp afyrigdarffwrvnhfypfypldeeldlnyitdnefvrnlppqrncrelreslkklgmg
Timeline for d1h7qa_: