Lineage for d1h7qa_ (1h7q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133077Family c.68.1.1: Spore coat polysaccharide biosynthesis protein SpsA [53449] (1 protein)
  6. 2133078Protein Spore coat polysaccharide biosynthesis protein SpsA [53450] (1 species)
  7. 2133079Species Bacillus subtilis [TaxId:1423] [53451] (5 PDB entries)
  8. 2133084Domain d1h7qa_: 1h7q A: [65704]
    complexed with mg, mn, tyd

Details for d1h7qa_

PDB Entry: 1h7q (more details), 2 Å

PDB Description: dtdp-manganese complex of spsa from bacillus subtilis
PDB Compounds: (A:) spore coat polysaccharide biosynthesis protein spsa

SCOPe Domain Sequences for d1h7qa_:

Sequence, based on SEQRES records: (download)

>d1h7qa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}
pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy
qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka
viysasktyhlnenrdivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywd
espafyrigdarffwrvnhfypfypldeeldlnyitdqsihfqlfeleknefvrnlppqr
ncrelreslkklgmg

Sequence, based on observed residues (ATOM records): (download)

>d1h7qa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}
pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy
qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka
viysasktyhlndivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywdesp
afyrigdarffwrvnhfypfypldeeldlnyitdnefvrnlppqrncrelreslkklgmg

SCOPe Domain Coordinates for d1h7qa_:

Click to download the PDB-style file with coordinates for d1h7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1h7qa_: