Lineage for d1h76a2 (1h76 A:342-687)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880102Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1880201Protein Transferrin [53897] (3 species)
  7. 1880229Species Pig (Sus scrofa) [TaxId:9823] [69626] (1 PDB entry)
  8. 1880231Domain d1h76a2: 1h76 A:342-687 [65700]
    complexed with co3, fe, nag

Details for d1h76a2

PDB Entry: 1h76 (more details), 2.15 Å

PDB Description: the crystal structure of diferric porcine serum transferrin
PDB Compounds: (A:) serotransferrin

SCOPe Domain Sequences for d1h76a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]}
eckkvrwcaigheetqkcdawsinsggkiecvsaentedciakivkgeadamsldggyiy
iagkcglvpvlaenyktegencvntpekgylavavvkkssgpdlnwnnlkgkkschtavd
rtagwnipmgllynkinsckfdqffgegcapgsqrnsslcalcigserapgreclannhe
ryygytgafrclvekgdvafvkdqvvqqntdgknkddwakdlkqmdfellcqngarepvd
naenchlarapnhavvarddkvtcvaeellkqqaqfgrhvtdcsssfcmfksntkdllfr
ddtqclarvgkttyesylgadyitavanlrkcstsklleactfhsa

SCOPe Domain Coordinates for d1h76a2:

Click to download the PDB-style file with coordinates for d1h76a2.
(The format of our PDB-style files is described here.)

Timeline for d1h76a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h76a1