SCOP 1.73: Domain d1h76a1: 1h76 A:3-333

Lineage for d1h76a1 (1h76 A:3-333)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Transferrin [53897] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [69626] (1 PDB entry)

8. Domain d1h76a1: 1h76 A:3-333 [65699]

Details for d1h76a1

PDB Entry: 1h76, 2.15 Å

PDB Description: the crystal structure of diferric porcine serum transferrin

PDB Compounds: (A:) serotransferrin

SCOP Domain Sequences for d1h76a1:

Sequence; same for both SEQRES and ATOM records:

>d1h76a1 c.94.1.2 (A:3-333) Transferrin {Pig (Sus scrofa) [TaxId: 9823]}
qktvrwctisnqeankcssfrenmskavkngplvscvkkssyldcikairdkeadavtld
aglvfeaglapynlkpvvaefygqkdnpqthyyavavvkkgsnfqwnqlqgkrschtglg
rsagwiipmgllydqlpeprkpiekavasffssscvpcadpvnfpklcqqcagkgaekca
csnhepyfgyagafnclkedagdvafvkhstvlenlpdkadrdqyellcrdntrrpvddy
encylaqvpshavvarsvdgqedsiwellnqaqehfgrdkspdfqlfssshgkdllfkds
angflkipskmdsslylgyqyvtalrnlree

Timeline for d1h76a1:

• d1h76a1 first appeared in SCOP 1.59
  
• d1h76a1 appears in SCOP 1.71
  
• d1h76a1 appears in SCOP 1.75
  
• d1h76a1 appears in the current release, SCOPe 2.08