Lineage for d1h74d1 (1h74 D:5-167)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2537705Protein Homoserine kinase [54233] (1 species)
  7. 2537706Species Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries)
  8. 2537712Domain d1h74d1: 1h74 D:5-167 [65697]
    Other proteins in same PDB: d1h74a2, d1h74b2, d1h74c2, d1h74d2
    complexed with adp, ags, ile, mg

Details for d1h74d1

PDB Entry: 1h74 (more details), 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile
PDB Compounds: (D:) homoserine kinase

SCOPe Domain Sequences for d1h74d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h74d1 d.14.1.5 (D:5-167) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipid

SCOPe Domain Coordinates for d1h74d1:

Click to download the PDB-style file with coordinates for d1h74d1.
(The format of our PDB-style files is described here.)

Timeline for d1h74d1: