Lineage for d1h74c2 (1h74 C:168-300)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863524Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 863525Family d.58.26.1: Homoserine kinase [55061] (1 protein)
  6. 863526Protein Homoserine kinase [55062] (1 species)
  7. 863527Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 863532Domain d1h74c2: 1h74 C:168-300 [65696]
    Other proteins in same PDB: d1h74a1, d1h74b1, d1h74c1, d1h74d1

Details for d1h74c2

PDB Entry: 1h74 (more details), 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile
PDB Compounds: (C:) homoserine kinase

SCOP Domain Sequences for d1h74c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h74c2 d.58.26.1 (C:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOP Domain Coordinates for d1h74c2:

Click to download the PDB-style file with coordinates for d1h74c2.
(The format of our PDB-style files is described here.)

Timeline for d1h74c2: