| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (6 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.26.1: Homoserine kinase [55061] (1 protein) |
| Protein Homoserine kinase [55062] (1 species) |
| Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries) |
| Domain d1h74c2: 1h74 C:168-300 [65696] Other proteins in same PDB: d1h74a1, d1h74b1, d1h74c1, d1h74d1 |
PDB Entry: 1h74 (more details), 1.9 Å
SCOP Domain Sequences for d1h74c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h74c2 d.58.26.1 (C:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv
Timeline for d1h74c2: