Lineage for d1h74c1 (1h74 C:5-167)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253872Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 253873Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 253965Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (4 proteins)
  6. 253966Protein Homoserine kinase [54233] (1 species)
  7. 253967Species Archaeon Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries)
  8. 253972Domain d1h74c1: 1h74 C:5-167 [65695]
    Other proteins in same PDB: d1h74a2, d1h74b2, d1h74c2, d1h74d2

Details for d1h74c1

PDB Entry: 1h74 (more details), 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile

SCOP Domain Sequences for d1h74c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h74c1 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii}
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipid

SCOP Domain Coordinates for d1h74c1:

Click to download the PDB-style file with coordinates for d1h74c1.
(The format of our PDB-style files is described here.)

Timeline for d1h74c1: