SCOP 1.73: Domain d1h74b2: 1h74 B:168-300

Lineage for d1h74b2 (1h74 B:168-300)

Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families)
common fold is elaborated with additional secondary structures
Family d.58.26.1: Homoserine kinase [55061] (1 protein)
Protein Homoserine kinase [55062] (1 species)
Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
Domain d1h74b2: 1h74 B:168-300 [65694]
Other proteins in same PDB: d1h74a1, d1h74b1, d1h74c1, d1h74d1

Details for d1h74b2

PDB Entry: 1h74 (more details), 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile

PDB Compounds: (B:) homoserine kinase

SCOP Domain Sequences for d1h74b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h74b2 d.58.26.1 (B:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOP Domain Coordinates for d1h74b2:

Click to download the PDB-style file with coordinates for d1h74b2.
(The format of our PDB-style files is described here.)

Timeline for d1h74b2: