SCOP 1.59: Domain d1h74b2: 1h74 B:168-300

Lineage for d1h74b2 (1h74 B:168-300)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.26: GHMP Kinase [55060] (2 families)

5. Family d.58.26.1: Homoserine kinase, C-terminal domain [55061] (1 protein)

6. Protein Homoserine kinase, C-terminal domain [55062] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)

8. Domain d1h74b2: 1h74 B:168-300 [65694]
   Other proteins in same PDB: d1h74a1, d1h74b1, d1h74c1, d1h74d1

Details for d1h74b2

PDB Entry: 1h74, 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile

SCOP Domain Sequences for d1h74b2:

Sequence; same for both SEQRES and ATOM records:

>d1h74b2 d.58.26.1 (B:168-300) Homoserine kinase, C-terminal domain {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

Timeline for d1h74b2:

• d1h74b2 is new in SCOP 1.59
  
• d1h74b2 appears in SCOP 1.61
  
• d1h74b2 appears in the current release, SCOPe 2.08