Lineage for d1h6ua2 (1h6u A:36-262)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2459992Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 2460014Protein Internalin H [69431] (1 species)
  7. 2460015Species Listeria monocytogenes [TaxId:1639] [69432] (1 PDB entry)
  8. 2460016Domain d1h6ua2: 1h6u A:36-262 [65689]
    Other proteins in same PDB: d1h6ua1

Details for d1h6ua2

PDB Entry: 1h6u (more details), 1.8 Å

PDB Description: internalin h: crystal structure of fused n-terminal domains.
PDB Compounds: (A:) internalin h

SCOPe Domain Sequences for d1h6ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}
gsitqptainvifpdpalanaikiaagksnvtdtvtqadldgittlsafgtgvttiegvq
ylnnliglelkdnqitdlaplknltkitelelsgnplknvsaiaglqsiktldltstqit
dvtplaglsnlqvlyldlnqitnisplagltnlqylsignaqvsdltplanlsklttlka
ddnkisdisplaslpnlievhlknnqisdvsplantsnlfivtltnq

SCOPe Domain Coordinates for d1h6ua2:

Click to download the PDB-style file with coordinates for d1h6ua2.
(The format of our PDB-style files is described here.)

Timeline for d1h6ua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6ua1