SCOP 1.59: Domain d1h6ua1: 1h6u A:263-343

Lineage for d1h6ua1 (1h6u A:263-343)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.6: Internalin Ig-like domain [68902] (5 proteins)

6. Protein Internalin H [69174] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [69175] (1 PDB entry)

8. Domain d1h6ua1: 1h6u A:263-343 [65688]
   Other proteins in same PDB: d1h6ua2

Details for d1h6ua1

PDB Entry: 1h6u, 1.8 Å

PDB Description: internalin h: crystal structure of fused n-terminal domains.

SCOP Domain Sequences for d1h6ua1:

Sequence; same for both SEQRES and ATOM records:

>d1h6ua1 b.1.1.6 (A:263-343) Internalin H {Listeria monocytogenes}
titnqpvfynnnlvvpnvvkgpsgapiapatisdngtyaspnltwnltsfinnvsytfnq
svtfknttvpfsgtvtqplte

Timeline for d1h6ua1:

• d1h6ua1 is new in SCOP 1.59
  
• d1h6ua1 appears in SCOP 1.61
  
• d1h6ua1 appears in the current release, SCOPe 2.08