Lineage for d1h6ta1 (1h6t A:241-321)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039355Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 2039369Protein Internalin B [69172] (1 species)
  7. 2039370Species Listeria monocytogenes [TaxId:1639] [69173] (2 PDB entries)
  8. 2039371Domain d1h6ta1: 1h6t A:241-321 [65686]
    Other proteins in same PDB: d1h6ta2, d1h6ta3

Details for d1h6ta1

PDB Entry: 1h6t (more details), 1.6 Å

PDB Description: internalin b: crystal structure of fused n-terminal domains.
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d1h6ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ta1 b.1.18.15 (A:241-321) Internalin B {Listeria monocytogenes [TaxId: 1639]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplke

SCOPe Domain Coordinates for d1h6ta1:

Click to download the PDB-style file with coordinates for d1h6ta1.
(The format of our PDB-style files is described here.)

Timeline for d1h6ta1: