Lineage for d1h6rb_ (1h6r B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.22: GFP-like [54510] (1 superfamily) Superfamily d.22.1: GFP-like [54511] (2 families) 
Family d.22.1.1: Fluorescent proteins [54512] (2 proteins) Protein Green fluorescent protein, GFP [54513] (1 species) Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (27 PDB entries) 
Domain d1h6rb_: 1h6r B: [65684]
Details for d1h6rb_
PDB Entry: 1h6r (more details), 1.5 Å
PDB Description: the oxidized state of a redox sensitive variant of green fluorescent protein
SCOP Domain Sequences for d1h6rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6rb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfivttgklpvpwptlv
ttfayglqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshcvyivadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylcyqsalskdpnekrdhmvllefvtaagith
SCOP Domain Coordinates for d1h6rb_:
Click to download the PDB-style file with coordinates for d1h6rb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h6rb_:
- d1h6rb_ first appeared in SCOP 1.59
- d1h6rb_ appears in SCOP 1.63
- d1h6rb_ appears in the current release, SCOPe 2.08, called d1h6rb1
View in 3D
