Lineage for d1h6ra1 (1h6r A:2-231)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2546832Protein Green fluorescent protein, GFP [54513] (5 species)
  7. 2546838Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (272 PDB entries)
    Uniprot P42212
  8. 2546891Domain d1h6ra1: 1h6r A:2-231 [65683]
    Other proteins in same PDB: d1h6ra2, d1h6rb2, d1h6rc2
    a redox sensitive variant
    complexed with cl

Details for d1h6ra1

PDB Entry: 1h6r (more details), 1.5 Å

PDB Description: the oxidized state of a redox sensitive variant of green fluorescent protein
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1h6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ra1 d.22.1.1 (A:2-231) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkfivttgklpvpwptlv
ttfxlqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshcvyivadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylcyqsalskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d1h6ra1:

Click to download the PDB-style file with coordinates for d1h6ra1.
(The format of our PDB-style files is described here.)

Timeline for d1h6ra1: