SCOP 1.75: Domain d1h6ia_: 1h6i A:

Lineage for d1h6ia_ (1h6i A:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (1 family)

5. Family f.19.1.1: Aquaporin-like [56895] (4 proteins)
   duplication: consist of two similar structural parts

6. Protein Aquaporin-1 [56896] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56897] (3 PDB entries)

8. Domain d1h6ia_: 1h6i A: [65682]

Details for d1h6ia_

PDB Entry: 1h6i, 3.54 Å

PDB Description: a refined structure of human aquaporin 1

PDB Compounds: (A:) aquaporin-1

SCOP Domain Sequences for d1h6ia_:

Sequence; same for both SEQRES and ATOM records:

>d1h6ia_ f.19.1.1 (A:) Aquaporin-1 {Human (Homo sapiens) [TaxId: 9606]}
lfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsvg
hisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrnd
ladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidytg
cginparsfgsavithnfsnhwifwvgpfiggalavliydfilap

Timeline for d1h6ia_:

• d1h6ia_ first appeared in SCOP 1.59
  
• d1h6ia_ appears in SCOP 1.73
  
• d1h6ia_ appears in SCOPe 2.01
  
• d1h6ia_ appears in the current release, SCOPe 2.08