Lineage for d1h6ha_ (1h6h A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238168Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 2238169Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 2238170Family d.189.1.1: PX domain [64269] (5 proteins)
    Pfam PF00787
  6. 2238171Protein p40phox NADPH oxidase [69718] (1 species)
  7. 2238172Species Human (Homo sapiens) [TaxId:9606] [69719] (1 PDB entry)
  8. 2238173Domain d1h6ha_: 1h6h A: [65681]
    complexed with phosphatidylinositol 3-phosphate
    complexed with gol, pib

Details for d1h6ha_

PDB Entry: 1h6h (more details), 1.7 Å

PDB Description: structure of the px domain from p40phox bound to phosphatidylinositol 3-phosphate
PDB Compounds: (A:) neutrophil cytosol factor 4

SCOPe Domain Sequences for d1h6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]}
avaqqlraesdfeqlpddvaisaniadieekrgftshfvfvievktkggskyliyrryrq
fhalqskleerfgpdskssalactlptlpakvyvgvkqeiaemripalnaymksllslpv
wvlmdedvriffyqspydseqvp

SCOPe Domain Coordinates for d1h6ha_:

Click to download the PDB-style file with coordinates for d1h6ha_.
(The format of our PDB-style files is described here.)

Timeline for d1h6ha_: