SCOP 1.63: Domain d1h6ha_: 1h6h A:

Lineage for d1h6ha_ (1h6h A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.189: PX domain [64267] (1 superfamily)
   beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch

4. Superfamily d.189.1: PX domain [64268] (1 family)

5. Family d.189.1.1: PX domain [64269] (3 proteins)

6. Protein p40phox NADPH oxidase [69718] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69719] (1 PDB entry)

8. Domain d1h6ha_: 1h6h A: [65681]
   coplexed with phosphatidylinositol 3-phosphate
   complexed with gol, pib

Details for d1h6ha_

PDB Entry: 1h6h, 1.7 Å

PDB Description: structure of the px domain from p40phox bound to phosphatidylinositol 3-phosphate

SCOP Domain Sequences for d1h6ha_:

Sequence; same for both SEQRES and ATOM records:

>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens)}
avaqqlraesdfeqlpddvaisaniadieekrgftshfvfvievktkggskyliyrryrq
fhalqskleerfgpdskssalactlptlpakvyvgvkqeiaemripalnaymksllslpv
wvlmdedvriffyqspydseqvp

Timeline for d1h6ha_:

• d1h6ha_ first appeared in SCOP 1.59
  
• d1h6ha_ appears in SCOP 1.61
  
• d1h6ha_ appears in SCOP 1.65
  
• d1h6ha_ appears in the current release, SCOPe 2.08