Lineage for d1h6ha_ (1h6h A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.189: PX domain [64267] (1 superfamily) Superfamily d.189.1: PX domain [64268] (1 family) 
Family d.189.1.1: PX domain [64269] (2 proteins) Protein p40phox NADPH oxidase [69718] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69719] (1 PDB entry) 
Domain d1h6ha_: 1h6h A: [65681]
Details for d1h6ha_
PDB Entry: 1h6h (more details), 1.7 Å
PDB Description: structure of the px domain from p40phox bound to phosphatidylinositol 3-phosphate
SCOP Domain Sequences for d1h6ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens)}
avaqqlraesdfeqlpddvaisaniadieekrgftshfvfvievktkggskyliyrryrq
fhalqskleerfgpdskssalactlptlpakvyvgvkqeiaemripalnaymksllslpv
wvlmdedvriffyqspydseqvp
SCOP Domain Coordinates for d1h6ha_:
Click to download the PDB-style file with coordinates for d1h6ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h6ha_:
- d1h6ha_ is new in SCOP 1.59
- d1h6ha_ appears in SCOP 1.61
- d1h6ha_ appears in the current release, SCOPe 2.08
View in 3D