SCOP 1.73: Domain d1h6dj2: 1h6d J:213-374

Lineage for d1h6dj2 (1h6d J:213-374)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
   has many additional secondary structures

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)
   very similar to the glucose 6-phosphate dehydrogenase domain

7. Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)

8. Domain d1h6dj2: 1h6d J:213-374 [65675]
   Other proteins in same PDB: d1h6da1, d1h6db1, d1h6dc1, d1h6dd1, d1h6de1, d1h6df1, d1h6dg1, d1h6dh1, d1h6di1, d1h6dj1, d1h6dk1, d1h6dl1

Details for d1h6dj2

PDB Entry: 1h6d, 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol

PDB Compounds: (J:) precursor form of glucose-fructose oxidoreductase

SCOP Domain Sequences for d1h6dj2:

Sequence; same for both SEQRES and ATOM records:

>d1h6dj2 d.81.1.5 (J:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Timeline for d1h6dj2:

• d1h6dj2 first appeared in SCOP 1.59
  
• d1h6dj2 appears in SCOP 1.71
  
• d1h6dj2 appears in SCOP 1.75
  
• d1h6dj2 appears in the current release, SCOPe 2.08