Lineage for d1h6di1 (1h6d I:52-212,I:375-433)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828827Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 1828828Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries)
  8. 1828837Domain d1h6di1: 1h6d I:52-212,I:375-433 [65672]
    Other proteins in same PDB: d1h6da2, d1h6db2, d1h6dc2, d1h6dd2, d1h6de2, d1h6df2, d1h6dg2, d1h6dh2, d1h6di2, d1h6dj2, d1h6dk2, d1h6dl2
    complexed with gol, ndp

Details for d1h6di1

PDB Entry: 1h6d (more details), 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
PDB Compounds: (I:) precursor form of glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1h6di1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6di1 c.2.1.3 (I:52-212,I:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
aatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsri
ealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairaf
kagkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnk
pvrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

SCOPe Domain Coordinates for d1h6di1:

Click to download the PDB-style file with coordinates for d1h6di1.
(The format of our PDB-style files is described here.)

Timeline for d1h6di1: