SCOP 1.59: Domain d1h6dh2: 1h6d H:213-374

Lineage for d1h6dh2 (1h6d H:213-374)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries)

8. Domain d1h6dh2: 1h6d H:213-374 [65671]
   Other proteins in same PDB: d1h6da1, d1h6db1, d1h6dc1, d1h6dd1, d1h6de1, d1h6df1, d1h6dg1, d1h6dh1, d1h6di1, d1h6dj1, d1h6dk1, d1h6dl1

Details for d1h6dh2

PDB Entry: 1h6d, 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol

SCOP Domain Sequences for d1h6dh2:

Sequence; same for both SEQRES and ATOM records:

>d1h6dh2 d.81.1.5 (H:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Timeline for d1h6dh2:

• d1h6dh2 is new in SCOP 1.59
  
• d1h6dh2 appears in SCOP 1.61
  
• d1h6dh2 appears in the current release, SCOPe 2.08