Lineage for d1h6dh2 (1h6d H:213-374)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135207Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
  6. 135229Protein Glucose-fructose oxidoreductase [55377] (1 species)
  7. 135230Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries)
  8. 135238Domain d1h6dh2: 1h6d H:213-374 [65671]
    Other proteins in same PDB: d1h6da1, d1h6db1, d1h6dc1, d1h6dd1, d1h6de1, d1h6df1, d1h6dg1, d1h6dh1, d1h6di1, d1h6dj1, d1h6dk1, d1h6dl1

Details for d1h6dh2

PDB Entry: 1h6d (more details), 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol

SCOP Domain Sequences for d1h6dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6dh2 d.81.1.5 (H:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

SCOP Domain Coordinates for d1h6dh2:

Click to download the PDB-style file with coordinates for d1h6dh2.
(The format of our PDB-style files is described here.)

Timeline for d1h6dh2: