SCOP 1.59: Domain d1h6dh1: 1h6d H:53-212,H:375-433

Lineage for d1h6dh1 (1h6d H:53-212,H:375-433)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)

6. Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [51826] (6 PDB entries)

8. Domain d1h6dh1: 1h6d H:53-212,H:375-433 [65670]
   Other proteins in same PDB: d1h6da2, d1h6db2, d1h6dc2, d1h6dd2, d1h6de2, d1h6df2, d1h6dg2, d1h6dh2, d1h6di2, d1h6dj2, d1h6dk2, d1h6dl2

Details for d1h6dh1

PDB Entry: 1h6d, 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol

SCOP Domain Sequences for d1h6dh1:

Sequence; same for both SEQRES and ATOM records:

>d1h6dh1 c.2.1.3 (H:53-212,H:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

Timeline for d1h6dh1:

• d1h6dh1 is new in SCOP 1.59
  
• d1h6dh1 appears in SCOP 1.61
  
• d1h6dh1 appears in the current release, SCOPe 2.08