Lineage for d1h6da2 (1h6d A:213-374)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1916230Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 1916263Protein Glucose-fructose oxidoreductase [55377] (1 species)
    very similar to the glucose 6-phosphate dehydrogenase domain
  7. 1916264Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)
  8. 1916265Domain d1h6da2: 1h6d A:213-374 [65657]
    Other proteins in same PDB: d1h6da1, d1h6db1, d1h6dc1, d1h6dd1, d1h6de1, d1h6df1, d1h6dg1, d1h6dh1, d1h6di1, d1h6dj1, d1h6dk1, d1h6dl1
    complexed with gol, ndp

Details for d1h6da2

PDB Entry: 1h6d (more details), 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
PDB Compounds: (A:) precursor form of glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1h6da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6da2 d.81.1.5 (A:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

SCOPe Domain Coordinates for d1h6da2:

Click to download the PDB-style file with coordinates for d1h6da2.
(The format of our PDB-style files is described here.)

Timeline for d1h6da2: