SCOP 1.67: Domain d1h6cb2: 1h6c B:213-374

Lineage for d1h6cb2 (1h6c B:213-374)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
   has many additional secondary structures

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)
   very similar to the glucose 6-phosphate dehydrogenase domain

7. Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries)

8. Domain d1h6cb2: 1h6c B:213-374 [65655]
   Other proteins in same PDB: d1h6ca1, d1h6cb1
   complexed with gol, ndp, sin

Details for d1h6cb2

PDB Entry: 1h6c, 2.2 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with succinate

SCOP Domain Sequences for d1h6cb2:

Sequence; same for both SEQRES and ATOM records:

>d1h6cb2 d.81.1.5 (B:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Timeline for d1h6cb2:

• d1h6cb2 first appeared in SCOP 1.59
  
• d1h6cb2 appears in SCOP 1.65
  
• d1h6cb2 appears in SCOP 1.69
  
• d1h6cb2 appears in the current release, SCOPe 2.08