SCOP 1.59: Domain d1h6cb1: 1h6c B:53-212,B:375-433

Lineage for d1h6cb1 (1h6c B:53-212,B:375-433)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)

6. Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [51826] (6 PDB entries)

8. Domain d1h6cb1: 1h6c B:53-212,B:375-433 [65654]
   Other proteins in same PDB: d1h6ca2, d1h6cb2

Details for d1h6cb1

PDB Entry: 1h6c, 2.2 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with succinate

SCOP Domain Sequences for d1h6cb1:

Sequence; same for both SEQRES and ATOM records:

>d1h6cb1 c.2.1.3 (B:53-212,B:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

Timeline for d1h6cb1:

• d1h6cb1 is new in SCOP 1.59
  
• d1h6cb1 appears in SCOP 1.61
  
• d1h6cb1 appears in the current release, SCOPe 2.08