![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species) |
![]() | Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries) |
![]() | Domain d1h6ba1: 1h6b A:53-212,A:375-433 [65648] Other proteins in same PDB: d1h6ba2, d1h6bb2 |
PDB Entry: 1h6b (more details), 2.6 Å
SCOP Domain Sequences for d1h6ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ba1 c.2.1.3 (A:53-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
Timeline for d1h6ba1: