Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (4 proteins) has many additional secondary structures |
Protein Glucose-fructose oxidoreductase [55377] (1 species) very similar to the glucose 6-phosphate dehydrogenase domain |
Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries) |
Domain d1h6ab2: 1h6a B:213-374 [65647] Other proteins in same PDB: d1h6aa1, d1h6ab1 |
PDB Entry: 1h6a (more details), 2.5 Å
SCOP Domain Sequences for d1h6ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ab2 d.81.1.5 (B:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis} dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan
Timeline for d1h6ab2: