Lineage for d1h6ab2 (1h6a B:213-374)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259192Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 259193Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 259397Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
    has many additional secondary structures
  6. 259419Protein Glucose-fructose oxidoreductase [55377] (1 species)
    very similar to the glucose 6-phosphate dehydrogenase domain
  7. 259420Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries)
  8. 259436Domain d1h6ab2: 1h6a B:213-374 [65647]
    Other proteins in same PDB: d1h6aa1, d1h6ab1
    complexed with ndp

Details for d1h6ab2

PDB Entry: 1h6a (more details), 2.5 Å

PDB Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis

SCOP Domain Sequences for d1h6ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ab2 d.81.1.5 (B:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

SCOP Domain Coordinates for d1h6ab2:

Click to download the PDB-style file with coordinates for d1h6ab2.
(The format of our PDB-style files is described here.)

Timeline for d1h6ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6ab1