Lineage for d1h6ab2 (1h6a B:213-374)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193860Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 193861Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 194060Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
  6. 194082Protein Glucose-fructose oxidoreductase [55377] (1 species)
  7. 194083Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries)
  8. 194099Domain d1h6ab2: 1h6a B:213-374 [65647]
    Other proteins in same PDB: d1h6aa1, d1h6ab1

Details for d1h6ab2

PDB Entry: 1h6a (more details), 2.5 Å

PDB Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis

SCOP Domain Sequences for d1h6ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ab2 d.81.1.5 (B:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

SCOP Domain Coordinates for d1h6ab2:

Click to download the PDB-style file with coordinates for d1h6ab2.
(The format of our PDB-style files is described here.)

Timeline for d1h6ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6ab1