Lineage for d1h6ab1 (1h6a B:53-212,B:375-433)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118465Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 118466Species Zymomonas mobilis [TaxId:542] [51826] (6 PDB entries)
  8. 118482Domain d1h6ab1: 1h6a B:53-212,B:375-433 [65646]
    Other proteins in same PDB: d1h6aa2, d1h6ab2

Details for d1h6ab1

PDB Entry: 1h6a (more details), 2.5 Å

PDB Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis

SCOP Domain Sequences for d1h6ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ab1 c.2.1.3 (B:53-212,B:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

SCOP Domain Coordinates for d1h6ab1:

Click to download the PDB-style file with coordinates for d1h6ab1.
(The format of our PDB-style files is described here.)

Timeline for d1h6ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6ab2