Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species) |
Species Zymomonas mobilis [TaxId:542] [51826] (6 PDB entries) |
Domain d1h6aa1: 1h6a A:53-212,A:375-433 [65644] Other proteins in same PDB: d1h6aa2, d1h6ab2 |
PDB Entry: 1h6a (more details), 2.5 Å
SCOP Domain Sequences for d1h6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6aa1 c.2.1.3 (A:53-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis} atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
Timeline for d1h6aa1: