SCOP 1.67: Domain d1h6aa1: 1h6a A:53-212,A:375-433

Lineage for d1h6aa1 (1h6a A:53-212,A:375-433)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [51826] (6 PDB entries)

8. Domain d1h6aa1: 1h6a A:53-212,A:375-433 [65644]
   Other proteins in same PDB: d1h6aa2, d1h6ab2

Details for d1h6aa1

PDB Entry: 1h6a, 2.5 Å

PDB Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis

SCOP Domain Sequences for d1h6aa1:

Sequence; same for both SEQRES and ATOM records:

>d1h6aa1 c.2.1.3 (A:53-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

Timeline for d1h6aa1:

• d1h6aa1 first appeared in SCOP 1.59
  
• d1h6aa1 appears in SCOP 1.65
  
• d1h6aa1 appears in SCOP 1.69
  
• d1h6aa1 appears in the current release, SCOPe 2.08