Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Chloroplast protein translocon GTPase Toc34 [69485] (1 species) |
Species Pea (Pisum sativum) [TaxId:3888] [69486] (1 PDB entry) |
Domain d1h65c_: 1h65 C: [65642] complexed with gdp, mg |
PDB Entry: 1h65 (more details), 2 Å
SCOPe Domain Sequences for d1h65c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h65c_ c.37.1.8 (C:) Chloroplast protein translocon GTPase Toc34 {Pea (Pisum sativum) [TaxId: 3888]} vrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq vvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnks esifvdknlidklaaa
Timeline for d1h65c_: