Lineage for d1h65b_ (1h65 B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 121987Protein Chloroplast protein translocon GTPase Toc34 [69485] (1 species)
  7. 121988Species Garden pea (Pisum sativum) [TaxId:3888] [69486] (1 PDB entry)
  8. 121990Domain d1h65b_: 1h65 B: [65641]

Details for d1h65b_

PDB Entry: 1h65 (more details), 2 Å

PDB Description: crystal structure of pea toc34 - a novel gtpase of the chloroplast protein translocon

SCOP Domain Sequences for d1h65b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h65b_ c.37.1.8 (B:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum)}
tvrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvs
ispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyv
drldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseall
qvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnk
sesifvdknlidklaa

SCOP Domain Coordinates for d1h65b_:

Click to download the PDB-style file with coordinates for d1h65b_.
(The format of our PDB-style files is described here.)

Timeline for d1h65b_: