Lineage for d1h5sb_ (1h5s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898466Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2898485Protein RmlA (RfbA) [53465] (5 species)
  7. 2898503Species Escherichia coli [TaxId:562] [69568] (3 PDB entries)
  8. 2898513Domain d1h5sb_: 1h5s B: [65628]
    complexed with tmp

Details for d1h5sb_

PDB Entry: 1h5s (more details), 2.3 Å

PDB Description: thymidylyltransferase complexed with tmp
PDB Compounds: (B:) Glucose-1-phosphate thymidylyltransferase 1

SCOPe Domain Sequences for d1h5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5sb_ c.68.1.6 (B:) RmlA (RfbA) {Escherichia coli [TaxId: 562]}
mkmrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqd
tprfqqllgdgsqwglnlqykvqpspdglaqafiigeefiggddcalvlgdnifyghdlp
klmeaavnkesgatvfayhvndperygvvefdkngtaisleekplepksnyavtglyfyd
ndvvqmaknlkpsargeleitdinriyleqgrlsvalmgrgyawldtgthqslieasnfi
atieerqglkvscpeeiafrkgfidveqvrklavpliknnygqylykqtkd

SCOPe Domain Coordinates for d1h5sb_:

Click to download the PDB-style file with coordinates for d1h5sb_.
(The format of our PDB-style files is described here.)

Timeline for d1h5sb_: