Lineage for d1h4wa_ (1h4w A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2406117Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (15 PDB entries)
  8. 2406129Domain d1h4wa_: 1h4w A: [65622]
    complexed with ben, ca

Details for d1h4wa_

PDB Entry: 1h4w (more details), 1.7 Å

PDB Description: structure of human trypsin iv (brain trypsin)
PDB Compounds: (A:) trypsin iva

SCOPe Domain Sequences for d1h4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4wa_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinavkiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdsggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

SCOPe Domain Coordinates for d1h4wa_:

Click to download the PDB-style file with coordinates for d1h4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1h4wa_: