Lineage for d1h4wa_ (1h4w A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins) Protein Trypsin(ogen) [50515] (7 species) 
Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (1 PDB entry) 
Domain d1h4wa_: 1h4w A: [65622]
Details for d1h4wa_
PDB Entry: 1h4w (more details), 1.7 Å
PDB Description: structure of human trypsin iv (brain trypsin)
SCOP Domain Sequences for d1h4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4wa_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform)}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinavkiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdsggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
SCOP Domain Coordinates for d1h4wa_:
Click to download the PDB-style file with coordinates for d1h4wa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h4wa_:
- d1h4wa_ is new in SCOP 1.59
- d1h4wa_ appears in SCOP 1.61
- d1h4wa_ appears in the current release, SCOPe 2.08
View in 3D