Lineage for d1h4rb2 (1h4r B:215-313)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 564085Family b.55.1.5: Third domain of FERM [50776] (7 proteins)
  6. 564095Protein Merlin [69294] (2 species)
    the neurofibromatosis 2 tumor suppressor protein
  7. 564096Species Human (Homo sapiens) [TaxId:9606] [69295] (1 PDB entry)
  8. 564098Domain d1h4rb2: 1h4r B:215-313 [65620]
    Other proteins in same PDB: d1h4ra1, d1h4ra3, d1h4rb1, d1h4rb3
    complexed with so4

Details for d1h4rb2

PDB Entry: 1h4r (more details), 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

SCOP Domain Sequences for d1h4rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4rb2 b.55.1.5 (B:215-313) Merlin {Human (Homo sapiens)}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrka

SCOP Domain Coordinates for d1h4rb2:

Click to download the PDB-style file with coordinates for d1h4rb2.
(The format of our PDB-style files is described here.)

Timeline for d1h4rb2: